PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA96G00142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 239aa    MW: 27832.7 Da    PI: 9.1035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA96G00142genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.2e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l  +v ++G g+W++ +   g  R +k+c++rw +yl
       AA96G00142 20 KGLWSPEEDEKLRSYVLKHGHGCWTSLPLQAGIERNGKSCRLRWVNYL 67
                     678*****************************66************97 PP

2Myb_DNA-binding50.16.5e-1673118148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      + ++T++E+  l+ ++  lG++ W+ I+++++ gRt++++k++w++yl
       AA96G00142  73 KSSFTKDEESTLLYLHSILGNK-WSQISQHLP-GRTDNEVKNYWHSYL 118
                      5689******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4771567IPR017930Myb domain
SMARTSM007174.3E-111969IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-2819114IPR009057Homeodomain-like
PfamPF002491.6E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-212174IPR009057Homeodomain-like
CDDcd001673.26E-82367No hitNo description
PROSITE profilePS5129424.61168122IPR017930Myb domain
SMARTSM007172.4E-1572120IPR001005SANT/Myb domain
PfamPF002495.2E-1473118IPR001005SANT/Myb domain
CDDcd001673.39E-1075118No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2475122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVYKVEKSNK KMKLKEKQRK GLWSPEEDEK LRSYVLKHGH GCWTSLPLQA GIERNGKSCR  60
LRWVNYLRPG LKKSSFTKDE ESTLLYLHSI LGNKWSQISQ HLPGRTDNEV KNYWHSYLKK  120
KITSKITNSQ SISEKCSITN VEKRINSQIS KFSPKIVFTE WLDSSLVMNQ SSQNSNYVQD  180
FGKETTKIPD PINLEINYME NIVQNTNLML DEGISEIEFC SSFSDSFLFD CLINEQQLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25201247110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404203.11e-102hypothetical protein EUTSA_v10010657mg
TrEMBLV4NHJ31e-102V4NHJ3_EUTSA; Uncharacterized protein
STRINGAT3G48920.12e-97(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.12e-80myb domain protein 45